Designing secure access with ZTNA
2026-06-02T20:52:23Z•9e121eb57735334566192cd3128b6b588acb1038a4fa15f86f2e64ad8c272938
agentic-aiai-securityapt28china-nexuscovert-networkscross-domaindisplay-securitydns-hijackingmessaging-app-targetingnhspasskeyspasswordlesspatch-wavepatchingrouterssilentglasssoc-metricsvulnerability-managementzero-trustztna
What happened
This NCSC feed aggregates guidance and advisories covering enterprise and national cyber resilience: designing Zero Trust Network Access (ZTNA), moving to passkeys (passwordless authentication), cautious adoption and use of agentic/AI tools (including using AI to find vulnerabilities), and preparing for a large ‘vulnerability patch wave’. It highlights active threat activity and mitigation: China‑nexus covert networks of compromised edge devices and an advisory on defence, and Russian APT28 exploiting vulnerable routers for DNS‑hijacking operations. Other items include new cross‑domain and NHS
Why it matters
A reviewed impact interpretation has not been published for this record.
Evidence and limitations
- Source ID
- uk_ncsc_all_rss
- Record identifier
- 9e121eb57735334566192cd3128b6b588acb1038a4fa15f86f2e64ad8c272938
- Enrichment time
- 2026-06-02T20:52:23Z
- AI-assisted enrichment
- Yes
This record may overlap with other records. Its enrichment can be incomplete or wrong, and machine assistance was used. Validate consequential decisions against the linked source and your own environment.